PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_012034-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 366aa    MW: 41500.7 Da    PI: 9.5358
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_012034-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.2e-15453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rWT+eEd +l  +vkq+G++ W++++++m+  + R +k+c +rw +yl
  AHYPO_012034-RA  4 RQRWTAEEDSILSAYVKQFGPREWHLVSQRMNttLDRDAKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding36.79.6e-1259104148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  y+
  AHYPO_012034-RA  59 KGSLTAEEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVYK 104
                      6788******************.*********.*******99998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.669153IPR017930Myb domain
SMARTSM007174.8E-13355IPR001005SANT/Myb domain
SuperFamilySSF466896.97E-22498IPR009057Homeodomain-like
CDDcd001675.96E-9653No hitNo description
Gene3DG3DSA:1.10.10.601.2E-19660IPR009057Homeodomain-like
PfamPF139213.4E-14768No hitNo description
PROSITE profilePS5129423.50254108IPR017930Myb domain
SMARTSM007171.3E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-1561106IPR009057Homeodomain-like
CDDcd001671.88E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009615Biological Processresponse to virus
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010338Biological Processleaf formation
GO:0042742Biological Processdefense response to bacterium
GO:0045088Biological Processregulation of innate immune response
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:0000793Cellular Componentcondensed chromosome
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MKERQRWTAE EDSILSAYVK QFGPREWHLV SQRMNTTLDR DAKSCLERWK NYLKPGIKKG  60
SLTAEEQRLV IRLQAKHGNK WKKIAAEVPG RTAKRLGKWW EVYKEKQQRA NKDTNKCLEP  120
IDEGKYDHIL ETFAEKLVKE RVPMAASNGG FLHGGDHPLP LVTAPAAIPS TTMMLPPWLS  180
TSNAGRPPGS PSVTLSLAST TMPTPTPTPT PVAWLPQERG PHNIDNPPLT LGCLPSCLGG  240
LPQQMLISEL MDCCRELEEG HRALTAHKKE AAWRLNRVEL QLESEKGNRK REKMEEIEAK  300
INALREEQKS SMERIEAEYR EQLAGLRRDA EAKEQKLADQ WAAKHMRITK LLEQMGCRTR  360
LSEPN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-15792789MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-15792789C-Myb DNA-Binding Domain
1msf_C3e-15792789C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010695502.10.0PREDICTED: transcription factor AS1
RefseqXP_010695503.10.0PREDICTED: transcription factor AS1
SwissprotO809311e-159AS1_ARATH; Transcription factor AS1
TrEMBLA0A0K9S2260.0A0A0K9S226_SPIOL; Uncharacterized protein
STRINGPOPTR_0006s08610.11e-171(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-153MYB family protein